Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DHODH Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP159592
Description
DHODH Polyclonal specifically detects DHODH in Human samples. It is validated for Western Blot.Specifications
DHODH | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
DHOdehase, dihydroorotate dehydrogenase, dihydroorotate dehydrogenase, mitochondrial, Dihydroorotate oxidase, EC 1.3.3.1, EC 1.3.5.2, human complement of yeast URA1, POADS, URA1 | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Guinea pig: 92%; Chicken: 85%; Zebrafish: 85%; Xenopus: 84%. | |
Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q02127 | |
DHODH | |
Synthetic peptides corresponding to DHODH(dihydroorotate dehydrogenase) The peptide sequence was selected from the middle region of DHODH. Peptide sequence NLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAEL. | |
100 μL | |
metabolism | |
1723 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction