Invitrogen™ DHODH Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579153

Catalog No. PIPA579153

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human A431 whole cell, human HepG2 whole cell, human MCF-7 whole cell, rat testis tissue, rat liver tissue, mouse testis tissue, mouse liver tissue. IHC: mouse intestine tissue, rat intestine tissue, human lung cancer tissue.

The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane. [provided by RefSeq, Jul 2008].

Specifications

• Antigen: DHODH
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: DHODH
• Gene Alias: 2810417D19Rik; AI834883; DHOdehase; DHODH; dihydroorotate dehydrogenase; dihydroorotate dehydrogenase (quinone); dihydroorotate dehydrogenase (quinone), mitochondrial; dihydroorotate dehydrogenase, mitochondrial; dihydroorotate oxidase; human complement of yeast URA1; POADS; URA1
• Host Species: Rabbit
• Purification Method: Antigen Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 1723, 56749, 65156
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: O35435, Q02127, Q63707
• Gene Symbols: DHODH
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human DHODH (132-173aa RVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTE D).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov