Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA579153

Invitrogen™ DHODH Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579153
Change view
Click to view available options
Quantity:
100 μg
Catalog No. Quantity
PIPA579153 100 μg
1 options

Catalog No. PIPA579153

Supplier: Invitrogen™ PA579153

Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human A431 whole cell, human HepG2 whole cell, human MCF-7 whole cell, rat testis tissue, rat liver tissue, mouse testis tissue, mouse liver tissue. IHC: mouse intestine tissue, rat intestine tissue, human lung cancer tissue.

The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane. [provided by RefSeq, Jul 2008].
TRUSTED_SUSTAINABILITY

Specifications

Antigen DHODH
Applications Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene DHODH
Gene Accession No. O35435, Q02127, Q63707
Gene Alias 2810417D19Rik; AI834883; DHOdehase; DHODH; dihydroorotate dehydrogenase; dihydroorotate dehydrogenase (quinone); dihydroorotate dehydrogenase (quinone), mitochondrial; dihydroorotate dehydrogenase, mitochondrial; dihydroorotate oxidase; human complement of yeast URA1; POADS; URA1
Gene Symbols DHODH
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human DHODH (132-173aa RVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTE D).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1723, 56749, 65156
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.