DHRS2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154922

Catalog No. NBP154922

Description

DHRS2 Polyclonal specifically detects DHRS2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: DHRS2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: dehydrogenase/reductase (SDR family) member 2, dehydrogenase/reductase member 2, dehydrogenase/reductase SDR family member 2, Dicarbonyl reductase HEP27, EC 1.1.1.-, EC 1.1.1.184, HEP27, Protein D, SDR25C1, short chain dehydrogenase/reductase family 25C, member 1, short-chain alcohol dehydrogenase family member
• Host Species: Rabbit
• Molecular Weight of Antigen: 30 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q53GS4
• Gene Symbols: DHRS2
• Immunogen: Synthetic peptides corresponding to DHRS2(dehydrogenase/reductase (SDR family) member 2) The peptide sequence was selected from the middle region of DHRS2. Peptide sequence LEHCGGVDFLVCSAGVNPLVGSTLGTSEQIWDKILSVNVKSPALLLSQLL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10202
• Target Species: Human, Mouse, Rat, Canine, Equine, Rabbit
• Isotype: IgG