Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DHRS2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	DHRS2
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP154922 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP154922	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

DHRS2 Polyclonal specifically detects DHRS2 in Human samples. It is validated for Western Blot.

Specifications

Antigen	DHRS2
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	Q53GS4
Gene ID (Entrez)	10202
Immunogen	Synthetic peptides corresponding to DHRS2(dehydrogenase/reductase (SDR family) member 2) The peptide sequence was selected from the middle region of DHRS2. Peptide sequence LEHCGGVDFLVCSAGVNPLVGSTLGTSEQIWDKILSVNVKSPALLLSQLL.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	dehydrogenase/reductase (SDR family) member 2, dehydrogenase/reductase member 2, dehydrogenase/reductase SDR family member 2, Dicarbonyl reductase HEP27, EC 1.1.1.-, EC 1.1.1.184, HEP27, Protein D, SDR25C1, short chain dehydrogenase/reductase family 25C, member 1, short-chain alcohol dehydrogenase family member
Gene Symbols	DHRS2
Isotype	IgG
Molecular Weight of Antigen	30 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

DHRS2 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents