Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DHRS2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | DHRS2 |
---|---|
Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
DHRS2 Polyclonal specifically detects DHRS2 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
DHRS2 | |
Polyclonal | |
Rabbit | |
Human | |
dehydrogenase/reductase (SDR family) member 2, dehydrogenase/reductase member 2, dehydrogenase/reductase SDR family member 2, Dicarbonyl reductase HEP27, EC 1.1.1.-, EC 1.1.1.184, HEP27, Protein D, SDR25C1, short chain dehydrogenase/reductase family 25C, member 1, short-chain alcohol dehydrogenase family member | |
DHRS2 | |
IgG | |
Affinity Purified |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
10202 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EDREQLVAKALEHCGGVDFLVCSAGVNPLVGSTLGTSEQIWDKILSVNVKSPALLLSQL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title