Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DHRS9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | DHRS9 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
DHRS9 Polyclonal specifically detects DHRS9 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
DHRS9 | |
Polyclonal | |
Rabbit | |
metabolism | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
10170 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:LRRDMKAFGVHVSCIEPGLFKTNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGN | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
dehydrogenase/reductase (SDR family) member 9,3alpha-HSD, EC 1.1, EC 1.1.1, EC 1.1.1.105, member 4,3-alpha-HSD, NADP-dependent retinol dehydrogenase/reductase, RDH15, RDH-E2, RDHL3ALPHA-HSD, RDHTBE | |
DHRS9 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title