Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DHRSX Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP317830100UL
missing translation for 'nonReturnableMessage'
missing translation for 'returnPolicyLabel'
Description
DHRSX Polyclonal antibody specifically detects DHRSX in Human samples. It is validated for ImmunofluorescenceSpecifications
DHRSX | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
CXorf11, dehydrogenase/reductase (SDR family) X chromosome, dehydrogenase/reductase (SDR family) X-linked, DHRS5Xmember 1, EC 1.1, SDR46C1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: LDTLKESGSPGHSARVVTVSSATHYVAELNMDDLQSSACYSPHAAYAQSKLAL | |
100 μg | |
Lipid and Metabolism | |
207063 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction