DHX29 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP185272

Catalog No. NBP185272

Description

DHX29 Polyclonal specifically detects DHX29 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: DHX29
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: ATP-dependent RNA helicase DHX29, DDX29, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 29, DEAH (Asp-Glu-Ala-His) box polypeptide 29, DEAH box protein 29, EC 3.6.1, EC 3.6.4.13, FLJ21492, Nucleic acid helicase DDXx
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: DHX29
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LQAFSFKTKDIEDAMTNTLLYGGDLHSALDWLCLNLSDDALPEGFSQEFEEQQPKSRPKFQSPQIQATISPPLQPKTK
• Quantity: 0.1 mL
• Research Discipline: Chromatin Research
• Gene ID (Entrez): 54505
• Target Species: Human
• Isotype: IgG

For Research Use Only