Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DHX34 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | DHX34 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15729420
![]() |
Novus Biologicals
NBP15729420UL |
20 μL |
Each for $206.00
|
|
|||||
NBP157294
![]() |
Novus Biologicals
NBP157294 |
100 μL |
Each for $487.50
|
|
|||||
Description
DHX34 Polyclonal specifically detects DHX34 in Human samples. It is validated for Western Blot.Specifications
DHX34 | |
Polyclonal | |
Rabbit | |
DDX34, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 34, DEAH (Asp-Glu-Ala-His) box polypeptide 34, DEAH box protein 34, HRH1, KIAA0134 | |
DHX34 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
9704 | |
Synthetic peptides corresponding to DHX34(DEAH (Asp-Glu-Ala-His) box polypeptide 34) The peptide sequence was selected from the middle region of DHX34. Peptide sequence VPGRLFPITVVYQPQEAEPTTSKSEKLDPRPFLRVLESIDHKYPPEERGD. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title