Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DHX35 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | DHX35 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15734820
|
Novus Biologicals
NBP15734820UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP157348
|
Novus Biologicals
NBP157348 |
100 μL |
Each for $487.50
|
|
|||||
Description
DHX35 Polyclonal specifically detects DHX35 in Human samples. It is validated for Western Blot.Specifications
| DHX35 | |
| Polyclonal | |
| Rabbit | |
| Q9H5Z1 | |
| 60625 | |
| Synthetic peptides corresponding to DHX35(DEAH (Asp-Glu-Ala-His) box polypeptide 35) The peptide sequence was selected from the N terminal of DHX35. Peptide sequence MAAPVGPVKFWRPGTEGPGVSISEERQSLAENSGTTVVYNPYAALSIEQQ. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C20orf15, DDX35, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 35, DEAH (Asp-Glu-Ala-His) box polypeptide 35, DEAH box protein 35, DEAH-box protein 35, EC 3.6.1, EC 3.6.4.13, FLJ22759, KAIA0875, probable ATP-dependent RNA helicase DHX35 | |
| DHX35 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title