Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DIA1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen DIA1
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB126165
SDP
View Documents
Novus Biologicals
NBP310632100UL
100 μg
Each of 1 for $487.50
Only null left
Add to Cart
 
Description

Description

DIA1 Polyclonal specifically detects DIA1 in Mouse samples. It is validated for Western Blot.
Specifications

Specifications

DIA1
Western Blot
Unconjugated
Rabbit
Mouse
C3orf58, chromosome 3 open reading frame 58, DIA1
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse DIA1 (NP_001028317). Peptide sequence FLNVKNVYFAQYGEPREGGRRRVVLKRLGSQRELAQLDQSICKRATGRPR
Affinity purified
Western Blot 1.0 ug/ml
Polyclonal
Purified
RUO
PBS buffer, 2% sucrose
205428
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Videos
SDS
Documents

Documents

Product Certifications
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.