Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP31701325UL
This item is not returnable.
View return policy
Description
Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Polyclonal antibody specifically detects Dimethylarginine Dimethylaminohydrolase 1/DDAH1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
Dimethylarginine Dimethylaminohydrolase 1/DDAH1 | |
Polyclonal | |
Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
DDAH-1, DDAHdimethylargininase-1, DDAHI, Dimethylargininase-1, dimethylarginine dimethylaminohydrolase 1FLJ25539, EC 3.5.3.18, FLJ21264, N(G), N(G)-dimethylarginine dimethylaminohydrolase 1, NG, NG-dimethylarginine dimethylaminohydrolase | |
This antibody was developed against Recombinant Protein corresponding to amino acids: ERQHQLYVGVLGSKLGLQVVELPADESLPDCVFVEDVAVVCEETALITRPGAPSRRKE | |
25 μg | |
Signal Transduction | |
23576 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction