Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DIP13B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP21430325UL
Description
DIP13B Polyclonal specifically detects DIP13B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
DIP13B | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Adapter protein containing PH domain, PTB domain and leucine zipper motif 2, adaptor protein containing PH domain, PTB domain and leucine zipper motif 2, adaptor protein, phosphotyrosine interaction, PH domain and leucine zippercontaining 2, DCC-interacting protein 13-beta, DIP13BDIP13 beta, Dip13-beta, FLJ10659dip13-beta | |
Rabbit | |
Affinity Purified | |
RUO | |
55198 | |
Human | |
IgG |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
APPL2 | |
This antibody was developed against a recombinant protein corresponding to the amino acids: PMIGFAHGQINFFKKGAEMFSKRMDSFLSSVADMVQSIQVELEAEAEKMRVSQQELLSVDESVYTPDSDVAAPQINRNLIQK | |
25ul | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction