Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DIRAS1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15893520UL
Description
DIRAS1 Polyclonal specifically detects DIRAS1 in Human samples. It is validated for Western Blot.Specifications
DIRAS1 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
O95057 | |
DIRAS1 | |
Synthetic peptides corresponding to DIRAS1(DIRAS family, GTP-binding RAS-like 1) The peptide sequence was selected from the middle region of DIRAS1. Peptide sequence KCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVK. | |
20 μL | |
Signal Transduction | |
148252 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
DIRAS family, GTP-binding RAS-like 1, Di-Ras1, Distinct subgroup of the Ras family member 1, GBTS1Small GTP-binding tumor suppressor 1, GTP-binding protein Di-Ras1, Ras-related inhibitor of cell growth, Rig, RIGFLJ42681 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction