Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. DIRAS1 Antibody, Novus Biologicals™

DIRAS1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15893520 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
20 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15893520 20 μL
NBP158935 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15893520 Supplier Novus Biologicals Supplier No. NBP15893520UL

Description

Rabbit Polyclonal Antibody

DIRAS1 Polyclonal specifically detects DIRAS1 in Human samples. It is validated for Western Blot.

Specifications

Antigen DIRAS1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. O95057
Gene Alias DIRAS family, GTP-binding RAS-like 1, Di-Ras1, Distinct subgroup of the Ras family member 1, GBTS1Small GTP-binding tumor suppressor 1, GTP-binding protein Di-Ras1, Ras-related inhibitor of cell growth, Rig, RIGFLJ42681
Gene Symbols DIRAS1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to DIRAS1(DIRAS family, GTP-binding RAS-like 1) The peptide sequence was selected from the middle region of DIRAS1. Peptide sequence KCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVK.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 148252
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.