Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DIS3L2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | DIS3L2 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Description
DIS3L2 Polyclonal specifically detects DIS3L2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
DIS3L2 | |
Polyclonal | |
Purified | |
RUO | |
DIS3 mitotic control homolog (S. cerevisiae)-like 2, DIS3-like exonuclease 2, FAM6A, member A | |
DIS3L2 | |
IgG | |
Protein A purified |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
NP_689596 | |
129563 | |
Synthetic peptide directed towards the N terminal of human MGC42174. Peptide sequence: WKVVKPESNDKETEAAYESDIPEELCGHHLPQQSLKSYNDSPDVIVEAQF | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title