Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Dishevelled-1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$343.50 - $573.00
Specifications
Antigen | Dishevelled-1 |
---|---|
Dilution | Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
Dishevelled-1 Polyclonal antibody specifically detects Dishevelled-1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
Dishevelled-1 | |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Signal Transduction, Wnt Signaling Pathway | |
PBS, pH 7.2, 40% glycerol | |
1855 | |
IgG | |
Affinity purified |
Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
Polyclonal | |
Purified | |
RUO | |
Human | |
dishevelled 1 (homologous to Drosophila dsh), dishevelled, dsh homolog 1 (Drosophila), Dishevelled-1, DSH homolog 1, DVL, DVL1L1, MGC54245, segment polarity protein dishevelled homolog DVL-1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: PWPLGQGYPYQYPGPPPCFPPAYQDPGFSYGS | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title