DLGAP4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP233271

Catalog No. NBP233271

Description

DLGAP4 Polyclonal specifically detects DLGAP4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: DLGAP4
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q9Y2H0
• Gene Symbols: DLGAP4
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GVQVEDDWRSSVPSHSMSSRRDTDSDTQDANDSSCKSSERSLPDCTPHPNSISIDAGPRQAPKIAQIKRNLSYGDNSDPAL
• Quantity: 0.1 mL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 22839
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: DAP4FLJ20588, discs, large (Drosophila) homolog-associated protein 4, disks large associated protein 4, disks large-associated protein 4, DLP4, KIAA0964MGC131862, PSD-95/SAP90-binding protein 4, RP5-977B1.6, SAP90/PSD-95-associated protein 4, SAPAP-4, SAPAP4DAP-4
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only