DLL4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Catalog Number	Mfr. No.	Quantity
NBP186413	Novus Biologicals NBP186413	0.1 mL

Description

DLL4 Polyclonal specifically detects DLL4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: DLL4
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: delta 4, Delta 4 precursor, delta ligand 4, delta4, delta-like 4 (Drosophila), delta-like 4 homolog, delta-like 4 homolog (Drosophila), delta-like 4 protein, delta-like protein 4, Drosophila Delta homolog 4, hdelta2, MGC126344, notch ligand delta-2, notch ligand DLL4
• Gene Symbols: DLL4
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50-1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Neuroscience
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 54567
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:CHDLENGLMCTCPAGFSGRRCEVRTSIDACASSPCFNRATCYTDLSTDTFVCNCPYGFVGSRCEFPVGL
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only