DNA Ligase IV Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 3 publications

Supplier:  Novus Biologicals NB11057379

Catalog No. NB11057379

Description

DNA Ligase IV Polyclonal specifically detects DNA Ligase IV in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

• Antigen: DNA Ligase IV
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DNA joinase, DNA ligase 4, DNA ligase IV, DNA repair enzyme, EC 6.5.1.1, ligase IV, DNA, ATP-dependent, Polydeoxyribonucleotide synthase [ATP] 4, polynucleotide ligase, sealase
• Host Species: Rabbit
• Molecular Weight of Antigen: 104 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: DNA Ligase IV
• Target Species: Human, Mouse
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml, Knockdown Validated
• Gene Accession No.: P49917
• Gene Symbols: LIG4
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DNA Ligase IV. Peptide Sequence DGERMQMHKDGDVYKYFSRNGYNYTDQFGASPTEGSLTPFIHNAFKADIQ. The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3981
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution. Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only