Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DNA Polymerase epsilon catalytic subunit A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | DNA Polymerase epsilon catalytic subunit A |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
DNA Polymerase epsilon catalytic subunit A Polyclonal specifically detects DNA Polymerase epsilon catalytic subunit A in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
DNA Polymerase epsilon catalytic subunit A | |
Polyclonal | |
Rabbit | |
Chromatin Research, DNA Polymerases, DNA Repair | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
5426 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:HLQRHNHLLWLSPTARPDLGGKEADDNCLVMEFDDQATVEINSSGCYSTVCVELDLQNLAVNTILQSHHVNDMEGADSMGISFDVIQ | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
DKFZp434F222, DNA polymerase epsilon catalytic subunit A, DNA polymerase II subunit A, EC 2.7.7, EC 2.7.7.7, POLE1FLJ21434, polymerase (DNA directed), epsilon | |
POLE | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title