DNA Polymerase gamma Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23380025UL

Catalog No. NB436748

Description

DNA Polymerase gamma Polyclonal specifically detects DNA Polymerase gamma in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: DNA Polymerase gamma
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: P54098
• Gene Symbols: POLG
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: FVKGTMKDIRENFQDLMQYCAQDVWATHEVFQQQLPLFLERCPHPVTLAGMLEMGVSYLPVNQNWERYLAEAQGTYEELQREMKKSLMD
• Quantity: 25 μL
• Research Discipline: DNA Polymerases, DNA Repair
• Gene ID (Entrez): 5428
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: DNA polymerase subunit gamma-1, EC 2.7.7.7, FLJ27114, MDP1, MIRAS, Mitochondrial DNA polymerase catalytic subunit, MTDPS4A, PolG, catalytic subunit, POLG1MTDPS4B, PolG-alpha, POLGAPEO, polymerase (DNA directed), gamma, SANDO, SCAE
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only