DNA polymerase sigma Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB438322	Novus Biologicals NBP21372825UL	25ul
NBP213728	Novus Biologicals NBP213728	0.1 mL

Description

DNA polymerase sigma Polyclonal antibody specifically detects DNA polymerase sigma in Human samples. It is validated for Western Blot, Immunocytochemistry, Immunofluorescence.

Specifications

• Antigen: DNA polymerase sigma
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human, Mouse, Rat
• Gene Alias: DNA polymerase kappa, DNA polymerase sigma, EC 2.7.7.7, LAK-1TUTase 5, PAP associated domain containing 7, POLKTRF41, POLSTUTASE5, polymerase (DNA directed) sigma, polymerase (DNA-directed) sigma, Terminal uridylyltransferase 5, Topoisomerase-related function protein 4-1, TRF4-1LAK1, TRF4PAP-associated domain-containing protein 7
• Gene Symbols: TENT4A
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 11044
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: PNPLSSPHLYHKQHNGMKLSMKGSHGHTQGGGYSSVGSGGVRPPVGNRGHHQYNRTGWRRKKHTHTRDSLPVSLSR
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only