Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DNA Primase small subunit Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19089725UL
Description
DNA Primase small subunit Polyclonal specifically detects DNA Primase small subunit in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
DNA Primase small subunit | |
Polyclonal | |
Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
DNA primase 1, DNA primase 49 kDa subunit, DNA primase small subunit, DNA primase subunit 48, EC 2.7.7, EC 2.7.7.-, MGC12308, p49, primase p49 subunit, primase polypeptide 1, 49kDa, primase, DNA, polypeptide 1 (49kDa) | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
PRIM1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:ELVFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSG | |
25 μL | |
Core ESC Like Genes, Lipid and Metabolism, Stem Cell Markers | |
5557 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction