DNAH12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23891625UL

Catalog No. NB396614

Description

DNAH12 Polyclonal specifically detects DNAH12 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: DNAH12
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Accession No.: Q6ZR08
• Gene Symbols: DNAH12
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LLLTMLADFYNLYIVENPHYKFSPSGNYFAPPKGTYEDYIEFIKKLPFTQHP
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: axonemal beta dynein heavy chain 12, axonemal dynein heavy chain isotype3, axonemal, heavy polypeptide 12, ciliary dynein heavy chain 12, DHC3, DLP12, DNAH12L, DNAH7L, DNAHC12, DNAHC3, DNHD2, dynein heavy chain 12, axonemal, dynein heavy chain domain-containing protein 2, dynein, axonemal, heavy chain 12, dynein, heavy chain-5, FLJ40427, FLJ44290, HDHC3, HL19, HL-19
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 201625
• Target Species: Human
• Isotype: IgG