Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DNAJB12 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | DNAJB12 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15944420
|
Novus Biologicals
NBP15944420UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP159444
|
Novus Biologicals
NBP159444 |
100 μL |
Each for $487.50
|
|
|||||
Description
DNAJB12 Polyclonal specifically detects DNAJB12 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| DNAJB12 | |
| Unconjugated | |
| RUO | |
| DJ10FLJ20027, DKFZp586B2023, DnaJ (Hsp40) homolog, subfamily B, member 12, dnaJ homolog subfamily B member 12, FLJ0027 | |
| DNAJB12 | |
| IgG | |
| 42 kDa |
| Polyclonal | |
| Rabbit | |
| Q9NXW2 | |
| 54788 | |
| Synthetic peptides corresponding to DNAJB12(DnaJ (Hsp40) homolog, subfamily B, member 12) The peptide sequence was selected from the middle region of DNAJB12. Peptide sequence ILILILVSALSQLMVSSPPYSLSPRPSVGHIHRRVTDHLGVVYYVGDTFS. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title