Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DNAJB12 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP317700100UL
This item is not returnable.
View return policy
Description
DNAJB12 Polyclonal antibody specifically detects DNAJB12 in Human samples. It is validated for Western Blot, ImmunofluorescenceSpecifications
DNAJB12 | |
Polyclonal | |
Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
DJ10FLJ20027, DKFZp586B2023, DnaJ (Hsp40) homolog, subfamily B, member 12, dnaJ homolog subfamily B member 12, FLJ0027 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: PPYSLSPRPSVGHIHRRVTDHLGVVYYVGDTFSEEYTGSSLKTVERNVEDDYIANLRNNCW | |
100 μg | |
Signal Transduction | |
54788 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Western Blot, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction