Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DNAJB13 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP26877025UL
Description
DNAJB13 Polyclonal antibody specifically detects DNAJB13 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
DNAJB13 | |
Polyclonal | |
Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
DnaJ (Hsp40) homolog, subfamily B, member 13,1700014P03Rik, DnaJ (Hsp40) related, subfamily B, member 13, dnaJ homolog subfamily B member 13, DnaJ-like protein, radial spoke 16 homolog A, RSPH16A, Testis and spermatogenesis cell-related protein 6, Testis spermatocyte apoptosis-related gene 6 protein, Testis spermatogenesis apoptosis-related gene 3 protein, Testis spermatogenesis apoptosis-related gene 6 protein, testis spermatogenesis apoptosis-related protein 6, TSARG3, TSARG5, TSARG6FLJ46748 | |
This antibody was developed against a recombinant protein corresponding to amino acids: WTTGYVFHGKPEKVFHEFFGGNNPFSEFFDAEGSEVDLNFGGLQGRGVKKQDPQVERDLYLSLE | |
25 μL | |
Apoptosis | |
374407 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunofluorescence | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol | |
Rabbit | |
Protein A purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction