Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. DNAJC15 Rabbit anti-Human, Mouse, Rat, Clone: 7D7X7, Novus Biologicals™

DNAJC15 Rabbit anti-Human, Mouse, Rat, Clone: 7D7X7, Novus Biologicals™
SDP

Catalog No. NB168068 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB168068 20 μg
NB168067 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB168068 Supplier Novus Biologicals Supplier No. NBP31648820UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Monoclonal Antibody

DNAJC15 Monoclonal antibody specifically detects DNAJC15 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunofluorescence

Specifications

Antigen DNAJC15
Applications Western Blot, Immunofluorescence
Classification Monoclonal
Clone 7D7X7
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias Cell growth-inhibiting gene 22 protein, DnaJ (Hsp40) homolog, subfamily C, member 15, DnaJ (Hsp40) homolog, subfamily D, member 1, DNAJ domain-containing, dnaJ homolog subfamily C member 15, DNAJD1, MCJHSD18, Methylation-controlled J protein
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 70-150 of human DNAJC15 (Q9Y5T4). ETAKKISTPSFSSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLETTTKH
Purification Method Affinity purified
Quantity 20 μg
Regulatory Status RUO
Research Discipline Cancer, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 29103
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.