DNAJC15 Rabbit anti-Human, Mouse, Rat, Clone: 7D7X7, Novus Biologicals™

Rabbit Monoclonal Antibody

Supplier:  Novus Biologicals NBP31648820UL

Catalog No. NB168068

Description

DNAJC15 Monoclonal antibody specifically detects DNAJC15 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunofluorescence

Specifications

• Antigen: DNAJC15
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified

• Applications: Western Blot, Immunofluorescence
• Clone: 7D7X7
• Dilution: Western Blot 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200
• Gene Alias: Cell growth-inhibiting gene 22 protein, DnaJ (Hsp40) homolog, subfamily C, member 15, DnaJ (Hsp40) homolog, subfamily D, member 1, DNAJ domain-containing, dnaJ homolog subfamily C member 15, DNAJD1, MCJHSD18, Methylation-controlled J protein
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 70-150 of human DNAJC15 (Q9Y5T4). ETAKKISTPSFSSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLETTTKH
• Quantity: 20 μg
• Research Discipline: Cancer, Signal Transduction
• Gene ID (Entrez): 29103
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG