Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DNASE1L2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00
Specifications
| Antigen | DNASE1L2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP19142920
|
Novus Biologicals
NBP19142920UL |
20 μL |
Each of 1 for $206.00
|
|
|||||
Description
DNASE1L2 Polyclonal specifically detects DNASE1L2 in Rat samples. It is validated for Western Blot.Specifications
| DNASE1L2 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| deoxyribonuclease I-like 2, deoxyribonuclease-1-like 2, DHP1, DNAS1L2, DNase I homolog protein DHP1, DNase I-like 2 | |
| DNASE1L2 | |
| IgG | |
| Affinity Purified | |
| 40 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| XP_002724704 | |
| 1775 | |
| Synthetic peptide directed towards the middle region of human LOC100364462. Peptide sequence LIPLHAAPNQAVAEIDALYDVYLDVIDKWNTDDMLFLGDFNADCKYVKAH. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title