Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DNLZ Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | DNLZ |
---|---|
Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
DNLZ Polyclonal specifically detects DNLZ in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
DNLZ | |
Polyclonal | |
Rabbit | |
Human | |
728489 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LGWFSDLNGKRNIEEILTARGEQVHRVAGEGALELVLEAAGAPTSTAAPEAGE | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
BA413M3.2, C9orf151, Chromosome 9 Open Reading Frame 151, DNL-Type Zinc Finger, DNL-Type Zinc Finger Protein, HEP1, Homolog (Yeast), HSP70 Escort Protein, Hsp70-Escort Protein 1, MtHsp70-Escort Protein, TIMM15, Translocase Of Inner Mitochondrial Membrane 15 ZIM17 | |
DNLZ | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title