Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Dnmt2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP24867025UL
Description
Dnmt2 Polyclonal antibody specifically detects Dnmt2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
| Dnmt2 | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| DMNT2, DNA (cytosine-5-)-methyltransferase 2, DNA (cytosine-5)-methyltransferase-like protein 2, DNA methyltransferase homolog HsaIIP, DNA methyltransferase-2, DNA MTase homolog HsaIIP, Dnmt2, EC 2.1.1, EC 2.1.1.29, M.HsaIIP, MHSAIIP, PuMet, RNMT1, tRNA (cytosine-5-)-methyltransferase, tRNA aspartic acid methyltransferase 1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: KIESVHPQKYAMDVENKIQEKNVEPNISFDGSIQCSGKDAILFKLETAEEIHRKNQQDSDLSVKMLKDFLEDDTDVNQYLLPPKSLLRYAL | |
| 25 μL | |
| Chromatin Research, Epigenetics | |
| 1787 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction