Dnmt3L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23907625UL

Catalog No. NB436016

Description

Dnmt3L Polyclonal specifically detects Dnmt3L in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Dnmt3L
• Classification: Polyclonal
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: DNA (cytosine-5-)-methyltransferase 3-like, DNA (cytosine-5)-methyltransferase 3-like, human cytosine-5-methyltransferase 3-like protein, 10cytosine-5-methyltransferase 3-like protein, MGC1090
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Gene Accession No.: Q9UJW3
• Gene Symbols: DNMT3L
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GKVHAMSNWVCYLCLPSSRSGLLQRRRKWRSQLKAFYDRESENPLEMFETVPVWRRQPVRVL
• Quantity: 25 μL
• Research Discipline: Chromatin Research
• Gene ID (Entrez): 29947
• Target Species: Human
• Isotype: IgG