Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Dnmt3L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP239076
Description
Dnmt3L Polyclonal specifically detects Dnmt3L in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Dnmt3L | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin | |
Q9UJW3 | |
DNMT3L | |
This antibody was developed against a recombinant protein corresponding to amino acids: GKVHAMSNWVCYLCLPSSRSGLLQRRRKWRSQLKAFYDRESENPLEMFETVPVWRRQPVRVL | |
0.1 mL | |
Chromatin Research | |
29947 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
DNA (cytosine-5-)-methyltransferase 3-like, DNA (cytosine-5)-methyltransferase 3-like, human cytosine-5-methyltransferase 3-like protein, 10cytosine-5-methyltransferase 3-like protein, MGC1090 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction