Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DOC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | DOC1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
DOC1 Polyclonal specifically detects DOC1 in Human samples. It is validated for Western Blot.Specifications
DOC1 | |
Polyclonal | |
Rabbit | |
90 kDa GPBP-interacting protein, downregulated in ovarian cancer 1 81 kDa isoform, filamin A interacting protein 1-like, GIP130a, GIP130b, GIP130c | |
FILIP1L | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
11259 | |
Synthetic peptides corresponding to FILIP1L(filamin A interacting protein 1-like) The peptide sequence was selected from the middle region of FILIP1L. Peptide sequence KSLRPSLNGRRISDPQVFSKEVQTEAVDNEPPDYKSLIPLERAVINGQLY. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title