Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DOCK10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$254.42 - $728.30

Specifications

Antigen	DOCK10
Applications	Immunocytochemistry, Immunofluorescence
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP258637 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP258637	100 μL	Each for $728.30	Only null left	Sign In or Register to check your price. Add to Cart

NB393349 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP25863725UL	25 μL	Each for $254.42	Only null left	Sign In or Register to check your price. Add to Cart

Description

DOCK10 Polyclonal specifically detects DOCK10 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen	DOCK10
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene ID (Entrez)	55619
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LDSLDNSVTCECTPEETDSSENNLHADFAKYLTETEDTVKTTRNMERLNLFSLDPDIDTLKLQKKDLLEPESVIKPFEEKAAKRIMIICKALNSN
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Applications	Immunocytochemistry, Immunofluorescence
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	dedicator of cytokinesis 10, dedicator of cytokinesis protein 10, DKFZp781A1532, DRIP2, KIAA0694protein zizimin 3, Nbla10300, ZIZ3dopamine receptor interacting protein 2, zizimin3, zizimin-3
Gene Symbols	DOCK10
Isotype	IgG
Purification Method	Affinity Purified

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

DOCK10 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents