Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
                
Learn More
Learn More
                                    DOG1/TMEM16A Antibody (DG1/447 + DOG-1.1), DyLight 755, Novus Biologicals™
                                    
                                    
                                    
                                    
                                
                            
                            
                            
                            
Mouse Monoclonal Antibody
Supplier: Novus Biologicals NBP234604IR
Description
DOG1/TMEM16A Monoclonal specifically detects DOG1/TMEM16A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| DOG1/TMEM16A | |
| Monoclonal | |
| DyLight 755 | |
| ANO1, anoctamin 1, DOG1, ORAOV2, TAOS2, TMEM16A | |
| Mouse | |
| 114 kDa | |
| 0.1 mL | |
| Primary | |
| Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GISTs, including all c-kit negative GISTs. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GISTs is nearly identical: 94.4% vs. 94.7%. | |
| Store at 4C in the dark. | |
| IgG1 κ | 
| Western Blot, Flow Cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen) | |
| DG1/447 + DOG-1.1 | |
| Western Blot, Flow Cytometry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen | |
| ANO1 | |
| Recombinant human canine-1 protein (DG1/447) + A synthetic peptide from human canine-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1). (Uniprot: Q5XX6) | |
| Protein A or G purified | |
| RUO | |
| 55107 | |
| Human | |
| Purified | 
                    Product Content Correction
                
                Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
			
            For Research Use Only
Spot an opportunity for improvement?Share a Content Correction