Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DOG1/TMEM16A Antibody (DOG-1.1), Novus Biologicals™

Mouse Monoclonal Antibody
Supplier: Novus Biologicals NBP2443800.2MG
Description
Ensure accurate, reproducible results in Flow Cytometry, Immunohistochemistry (Paraffin), Immunofluorescence
DOG1/TMEM16A Monoclonal antibody specifically detects DOG1/TMEM16A in Human samples. It is validated for Flow Cytometry, Immunohistochemistry-Paraffin, Immunofluorescence.Specifications
DOG1/TMEM16A | |
Monoclonal | |
0.2mg/mL | |
Flow Cytometry 0.5 - 1 ug/million cells in 0.1 ml, Immunohistochemistry-Paraffin 0.25 - 0.5 ug/ml, Immunofluorescence 0.5 - 1.0 ug/ml | |
ANO1, anoctamin 1, DOG1, ORAOV2, TAOS2, TMEM16A | |
Mouse | |
Protein A or G purified | |
RUO | |
55107 | |
Human | |
Purified |
Flow Cytometry, Immunohistochemistry (Paraffin), Immunofluorescence | |
DOG-1.1 | |
Unconjugated | |
10mM PBS and 0.05% BSA with 0.05% Sodium Azide | |
TMEM16A | |
A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQL-LETCMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein. | |
0.2 mg | |
Primary | |
Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GISTs, including all c-kit negative GISTs. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GISTs is nearly identical: 94.4% vs. 94.7%. | |
Store at 4C. | |
IgG1 κ |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction