Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Dopamine D1R/DRD1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP31764425UL
This item is not returnable.
View return policy
Description
Dopamine D1R/DRD1 Polyclonal antibody specifically detects Dopamine D1R/DRD1 in Human samples. It is validated for Western Blot, ImmunofluorescenceSpecifications
| Dopamine D1R/DRD1 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| D(1A) dopamine receptor, D1DR, DADR, Dopamine D1 receptor, dopamine receptor D1, DRD1A | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: FRKAFSTLLGCYRLCPATNNAIETVSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPALSVILDYDTDVSLEKIQPITQNGQHP | |
| 25 μg | |
| GPCR, Neuroscience, Neurotransmission | |
| 1812 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction