Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DPP6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
| Antigen | DPP6 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
DPP6 Polyclonal specifically detects DPP6 in Human, Mouse samples. It is validated for Western Blot.Specifications
| DPP6 | |
| Polyclonal | |
| Rabbit | |
| P42658 | |
| 1804 | |
| Synthetic peptides corresponding to DPP6(dipeptidyl-peptidase 6) The peptide sequence was selected from the middle region of DPP6. Peptide sequence FLIIHPTADEKIHFQHTAELITQLIRGKANYSLQIYPDESHYFTSSSLKQ. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| dipeptidyl aminopeptidase IV-related protein, dipeptidyl aminopeptidase-like protein 6, Dipeptidyl aminopeptidase-related protein, Dipeptidyl peptidase 6, Dipeptidyl peptidase IV-like protein, dipeptidyl peptidase IV-related protein, Dipeptidyl peptidase VI, dipeptidylpeptidase 6, dipeptidyl-peptidase 6, dipeptidylpeptidase VI, DPP VI, DPPXFLJ55680, MGC46605, VF2 | |
| DPP6 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title