DPPA2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP185426

Catalog No. NBP185426

Description

DPPA2 Polyclonal specifically detects DPPA2 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: DPPA2
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: CT100, developmental pluripotency associated 2, developmental pluripotency-associated protein 2, PESCRG1cancer/testis antigen 100, Pluripotent embryonic stem cell-related gene 1 protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: DPPA2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:DWCQQLGLSTNGKKIEVYLRLHRHAYPEQRQDMPEMSQETRLQRCSRKRKAVTKRARLQRSYEMNERAEETNTVEVITSAPG
• Quantity: 0.1 mL
• Research Discipline: Developmental Biology, Stem Cells
• Gene ID (Entrez): 151871
• Target Species: Human
• Isotype: IgG

For Research Use Only