Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DPPII/QPP/DPP7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25579925UL
Description
DPPII/QPP/DPP7 Polyclonal specifically detects DPPII/QPP/DPP7 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
DPPII/QPP/DPP7 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL | |
carboxytripeptidase, Dipeptidyl aminopeptidase II, dipeptidyl arylamidase II, dipeptidyl peptidase 2, Dipeptidyl peptidase 7, Dipeptidyl peptidase II, dipeptidylpeptidase 7, dipeptidyl-peptidase 7, dipeptidyl-peptidase II, DPP II, DPP2, DPPII, EC 3.4.14.2, QPP, Quiescent cell proline dipeptidase | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
DPP7 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SNGNLDPWAGGGIRRNLSASVIAVTIQGGAHHLDLRASHPEDPASVVEARKLEATIIGEWVKAARREQQPALRG | |
25 μL | |
GPCR | |
29952 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction