Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DR1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $646.00
Specifications
Antigen | DR1 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
DR1 Polyclonal specifically detects DR1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
DR1 | |
Polyclonal | |
Rabbit | |
Stem Cell Markers | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
1810 | |
This antibody was developed against a recombinant protein corresponding to amino acids: EVKEVLQECKTVALKRRKASSRLENLGIPEEELLRQQQELFAKARQQQAELAQQEWLQMQQ | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
Down-regulator of transcription 1, down-regulator of transcription 1, TBP-binding (negative cofactor 2), NC2, NC2-BETA, Negative cofactor 2-beta, protein Dr1, TATA-binding protein-associated phosphoprotein | |
DR1 | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?
Product Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title