Invitrogen™ DR4 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA580143

Catalog No. PIPA580143

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat spleen tissue, mouse spleen tissue, MCF-7 whole cell. ICC/IF: U2OS cell .

TRAIL-R1 (CD261, DR4) is a type I transmembrane protein, also called TRAIL receptor 1. The ligand for this DR4 death receptor has been identified and termed TRAIL, which is a member of the TNF family. DR4, as many other receptors (Fas, TNFR1, etc.), mediates apoptosis and NF kappaB activation in many cells and tissues. Apoptosis, a programmed cell death, is a operating process in normal cellular differentiation and development of multicellular organisms. Apoptosis is induced by coupled of certain cytokines (TNF family - TNF, Fas ligand) and their death domain containing receptors (TNFR1, Fas receptor).

Specifications

• Antigen: DR4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: TNFRSF10A
• Gene Alias: APO2; CD261; cytotoxic TRAIL receptor; death receptor 4; DR4; MGC9365; sCD261; soluble CD261; soluble TRAIL; sTRAIL; TNF receptor superfamily member 10a; TNF-related apoptosis-inducing ligand receptor 1; TNFRSF10A; TRAIL R1; TRAIL receptor 1; TRAILR1; TRAIL-R1; TRAILR-1; tumor necrosis factor receptor superfamily member 10A; tumor necrosis factor receptor superfamily member 10a variant 2; tumor necrosis factor receptor superfamily, member 10a
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 8797
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot, Immunocytochemistry, Immunohistochemistry (Frozen), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: O00220
• Gene Symbols: TNFRSF10A
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human DR4 (99-131aa VLLQVVPSSAATIKLHDQSIGTQQWEHSPLGEL).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov