DRAK1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18498125UL

Catalog No. NB432414

Description

DRAK1 Polyclonal specifically detects DRAK1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: DRAK1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: DAP kinase-related apoptosis-inducing protein kinase 1, DRAK1death-associated protein kinase-related 1, EC 2.7.11.1, serine/threonine kinase 17a, serine/threonine kinase 17a (apoptosis-inducing), serine/threonine-protein kinase 17A
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: STK17A
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:RTLLVKKPEDRATAEECLKHPWLTQSSIQEPSFRMEKALEEANALQEGHSVPEINSDTDKSETKESIVTE
• Quantity: 25ul
• Research Discipline: Apoptosis, Cell Biology, Signal Transduction
• Gene ID (Entrez): 9263
• Target Species: Human
• Isotype: IgG

For Research Use Only