Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Drosha Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP157139
Description
Drosha Polyclonal specifically detects Drosha in Human samples. It is validated for Western Blot.Specifications
Drosha | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
Q9NRR4 | |
DROSHA | |
Synthetic peptides corresponding to RNASEN(ribonuclease type III, nuclear) The peptide sequence was selected from the middle region of RNASEN. Peptide sequence AAMDALEKYNFPQMAHQKRFIERKYRQELKEMRWEREHQEREPDETEDIK. | |
100 μL | |
Epigenetics, microRNA | |
29102 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with 0.09% Sodium Azide | |
drosha, double-stranded RNA-specific endoribonuclease, drosha, ribonuclease type III, EC 3.1.26.3, Etohi2, nuclear RNase III Drosha, p241, Protein Drosha, putative protein p241 which interacts with transcription factor Sp1, putative ribonuclease III, RANSE3L, ribonuclease 3, Ribonuclease III, ribonuclease III, nuclear, RN3nuclear, RNase III | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Expected identity based on immunogen sequence: Chicken: 84%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title