Drosha Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157139

Catalog No. NBP157139

Description

Drosha Polyclonal specifically detects Drosha in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Drosha
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NRR4
• Gene Symbols: DROSHA
• Immunogen: Synthetic peptides corresponding to RNASEN(ribonuclease type III, nuclear) The peptide sequence was selected from the middle region of RNASEN. Peptide sequence AAMDALEKYNFPQMAHQKRFIERKYRQELKEMRWEREHQEREPDETEDIK.
• Quantity: 100 μL
• Research Discipline: Epigenetics, microRNA
• Gene ID (Entrez): 29102
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with 0.09% Sodium Azide
• Gene Alias: drosha, double-stranded RNA-specific endoribonuclease, drosha, ribonuclease type III, EC 3.1.26.3, Etohi2, nuclear RNase III Drosha, p241, Protein Drosha, putative protein p241 which interacts with transcription factor Sp1, putative ribonuclease III, RANSE3L, ribonuclease 3, Ribonuclease III, ribonuclease III, nuclear, RN3nuclear, RNase III
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Chicken: 84%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG