DRP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB397230	Novus Biologicals NBP23420525UL	25 μL
NBP234205	Novus Biologicals NBP234205	0.1 mL

Description

DRP1 Polyclonal specifically detects DRP1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: DRP1
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Accession No.: O00429
• Gene ID (Entrez): 10059
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EADGKVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCE
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Apoptosis, Cell Biology, Mitochondrial Fusion Proteins, Neurodegeneration, Neuroscience, Signal Transduction
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: DLP1, DRP1Dnm1p/Vps1p-like protein, DVLPEC 3.6.5.5, Dymple, DYMPLEDYNIV-11, dynamin 1-like, Dynamin family member proline-rich carboxyl-terminal domain less, dynamin-1-like protein, Dynamin-like protein, Dynamin-like protein 4, Dynamin-like protein IV, Dynamin-related protein 1, FLJ41912, HDYNIV, VPS1
• Gene Symbols: DNM1L
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only