Dub3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179745

Catalog No. NBP179745

Description

Dub3 Polyclonal specifically detects Dub3 in Human samples. It is validated for Western Blot, Immunoprecipitation.

Specifications

• Antigen: Dub3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Deubiquitinating enzyme 17-like protein 2, Deubiquitinating protein 3, DUB-3, DUB3deubiquitinating enzyme 3, EC 3.1.2.15, EC 3.4.19.12, ubiquitin carboxyl-terminal hydrolase 17-like protein 2, ubiquitin specific peptidase 17-like 2, ubiquitin thioesterase 17-like protein 2, Ubiquitin thiolesterase 17-like protein 2, Ubiquitin-specific-processing protease 17-like protein 2
• Host Species: Rabbit
• Molecular Weight of Antigen: 59 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, KnockDown
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, KnockDown Validated
• Gene Accession No.: NP_958804
• Gene Symbols: USP17L2
• Immunogen: Synthetic peptide directed towards the middle region of human USP17L2. Peptide sequence FYIQKSEWERHSESVSRGREPRALGAEDTDRRATQGELKRDHPCLQAPEL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 377630
• Target Species: Human
• Isotype: IgG