Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Dub3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17974520UL
Description
Dub3 Polyclonal specifically detects Dub3 in Human samples. It is validated for Western Blot, Immunoprecipitation.Specifications
Dub3 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_958804 | |
USP17L2 | |
Synthetic peptide directed towards the middle region of human USP17L2. Peptide sequence FYIQKSEWERHSESVSRGREPRALGAEDTDRRATQGELKRDHPCLQAPEL. | |
Affinity Purified | |
RUO | |
377630 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Deubiquitinating enzyme 17-like protein 2, Deubiquitinating protein 3, DUB-3, DUB3deubiquitinating enzyme 3, EC 3.1.2.15, EC 3.4.19.12, ubiquitin carboxyl-terminal hydrolase 17-like protein 2, ubiquitin specific peptidase 17-like 2, ubiquitin thioesterase 17-like protein 2, Ubiquitin thiolesterase 17-like protein 2, Ubiquitin-specific-processing protease 17-like protein 2 | |
Rabbit | |
59 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction