Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Dub3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$499.50
Specifications
| Antigen | Dub3 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179745
|
Novus Biologicals
NBP179745 |
100 μL |
Each for $499.50
|
|
|||||
|
NBP17974520
|
Novus Biologicals
NBP17974520UL |
20 μL | N/A | N/A | N/A | ||||
Description
Dub3 Polyclonal specifically detects Dub3 in Human samples. It is validated for Western Blot, Immunoprecipitation.Specifications
| Dub3 | |
| Unconjugated | |
| RUO | |
| NP_958804 | |
| 377630 | |
| Synthetic peptide directed towards the middle region of human USP17L2. Peptide sequence FYIQKSEWERHSESVSRGREPRALGAEDTDRRATQGELKRDHPCLQAPEL. | |
| Primary |
| Polyclonal | |
| Rabbit | |
| Human | |
| Deubiquitinating enzyme 17-like protein 2, Deubiquitinating protein 3, DUB-3, DUB3deubiquitinating enzyme 3, EC 3.1.2.15, EC 3.4.19.12, ubiquitin carboxyl-terminal hydrolase 17-like protein 2, ubiquitin specific peptidase 17-like 2, ubiquitin thioesterase 17-like protein 2, Ubiquitin thiolesterase 17-like protein 2, Ubiquitin-specific-processing protease 17-like protein 2 | |
| USP17L2 | |
| IgG | |
| 59 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title