Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Dub3 Antibody, Novus Biologicals™

Dub3 Antibody, Novus Biologicals™
SDP

Catalog No. p-7109542 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP179745 100 μL
NBP17974520 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP179745 Supplier Novus Biologicals Supplier No. NBP179745
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Dub3 Polyclonal specifically detects Dub3 in Human samples. It is validated for Western Blot, Immunoprecipitation.

Specifications

Antigen Dub3
Applications Western Blot, KnockDown
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, KnockDown Validated
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_958804
Gene Alias Deubiquitinating enzyme 17-like protein 2, Deubiquitinating protein 3, DUB-3, DUB3deubiquitinating enzyme 3, EC 3.1.2.15, EC 3.4.19.12, ubiquitin carboxyl-terminal hydrolase 17-like protein 2, ubiquitin specific peptidase 17-like 2, ubiquitin thioesterase 17-like protein 2, Ubiquitin thiolesterase 17-like protein 2, Ubiquitin-specific-processing protease 17-like protein 2
Gene Symbols USP17L2
Host Species Rabbit
Immunogen Synthetic peptide directed towards the middle region of human USP17L2. Peptide sequence FYIQKSEWERHSESVSRGREPRALGAEDTDRRATQGELKRDHPCLQAPEL.
Molecular Weight of Antigen 59 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 377630
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.