Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DUS1L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | DUS1L |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
DUS1L Polyclonal specifically detects DUS1L in Human samples. It is validated for Western Blot.Specifications
| DUS1L | |
| Polyclonal | |
| Rabbit | |
| Q6P1R4 | |
| 64118 | |
| Synthetic peptides corresponding to DUS1L (dihydrouridine synthase 1-like (S. cerevisiae)) The peptide sequence was selected from the middle region of DUS1L)(50ug). Peptide sequence KPTGDLPFHWICQPYIRPGPREGSKEKAGARSKRALEEEEGGTEVLSKNK. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| dihydrouridine synthase 1-like (S. cerevisiae), DUS1, PP3111, tRNA-dihydrouridine synthase 1-like | |
| DUS1L | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title